Sale!

IGF-1 DES 1,3
In stock
$76.99$99.99
- Concentration
- 1 mg per vial
Free & Fast
Shipping
Earn
Rewards
Excellent
Service
IGF-1 DES 1,3 Summary
- Physical Appearance
- Fine White Lyophilized Powder
- Residue Sequence
- TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Solubility
- 100 μg/mL sterile diluent (distilled de-ionized water)
- Source
- Biosynthetic production
- Stability
- Lyophilized protein is to be stored at -20°C. It is recommended to aliquot the reconstituted (dissolved) protein into several discrete vials in order to avoid repeated freezing and thawing. Reconstituted protein can be stored at 4°C.
- Molar Mass
- 7371.4 g/mol
- CAS Number
- 112603-35-7
- Molecular Formula
- C319H501N91O96S7
Related Products
Accurate research is our priority.
Same Day Shipping
We offer same day shipping on all orders of in stock items placed before 12:00pm EST.
Dedicated Service
Our team is readily available to assist with all of your customer service requests.
Free Shipping
We've got you covered! Free shipping is available on any order over $50.
Earn Rewards
Earn points every time you buy from us and use them towards future orders!
