Sale!

IGF-1 DES 1,3

In stock

$69.99$99.99

Concentration
1 mg per vial
Purchase this product now and earn 70 Points!

This product is prepared for LABORATORY RESEARCH USE ONLY and may not be used for other purposes.

-
+

Free & Fast
Shipping

Earn
Rewards

Excellent
Service

IGF-1 DES 1,3 Summary

Physical Appearance
Fine White Lyophilized Powder
Residue Sequence
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Solubility
100 μg/mL sterile diluent (distilled de-ionized water)
Source
Biosynthetic production
Stability
Lyophilized protein is to be stored at -20°C. It is recommended to aliquot the reconstituted (dissolved) protein into several discrete vials in order to avoid repeated freezing and thawing. Reconstituted protein can be stored at 4°C.
Molar Mass
7371.4 g/mol
CAS Number
112603-35-7
Molecular Formula
C319H501N91O96S7

Accurate research is our priority.

Same Day Shipping
We offer same day shipping on all orders of in stock items placed before 12:00pm EST.
Dedicated Service
Our team is readily available to assist with all of your customer service requests.
Free Shipping
We've got you covered! Free shipping is available on any order over $50.
Earn Rewards
Earn points every time you buy from us and use them towards future orders!
Extreme Peptide vial with logo and indicators